N; This consensus was derived from the following PDB entries N; 1BAF 1BBD 1BBJ 1CGS 1DBB 1DFB 1EAP 1FAI 1FGV 1FIG 1FOR 1FRG N; 1FVC 1FVD 1GGI 1GIG 1HIL 1IGF 1IGI 1IGM 1IND 1JEL 1JHL 1MAM N; 1MCP 1MFA 1NBV 1NCB 1TET 1VFA 2CGR 2FB4 2FBJ 2GFB 2HFL 3HFM N; 4FAB 6FAB 7FAB 8FAB 1IVL 1LVD 1MCW 1REI 1WTL 2BJL 2MCG 2RHE N; N; The sequence for LFR1 is critical! If it's slightly wrong, you N; often end up with gaps at the N-ter rather than at position 9 N; N; The loops have sufficient x codes for the longest loops seen N; in the January 1995 release of the Kabat sequence database >P1;ABCONS Consensus for antibodies - PDB sequences Jan 1995 ~avltqppxs!%!s!gxxvti%C xxsxxxxxxxxxxxx!x wyqqkxgxxpk!liy xx%xxxs gvpxrfsgs!sgtxx%lxisx!xxedx!xy#C xxxxxxxxxxxxxxx fgxgtkLEIxKRA VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGECS* xvqlxxsgxxl!xpgxs!$!sCx!sG#%f% xxxxxxx wv$qxpg$xlew!! xixxxxxxgxxxyxxxxk! $xx!%xdxsxx%!yxxxxslxxeD%axyyCxx xxxxxxxxxxxxxxxxxxxxxxxxxx WGqGtxvtVss ASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC*